2.04 Rating by CuteStat

creeksideofbrentwood.org is 1 decade 4 years old. It is a domain having org extension. It has a global traffic rank of #548824 in the world. This website is estimated worth of $ 1,200.00 and have a daily income of around $ 5.00. As no active threats were reported recently by users, creeksideofbrentwood.org is SAFE to browse.

PageSpeed Score
27
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 877
Daily Pageviews: 1,754

Estimated Valuation

Income Per Day: $ 5.00
Estimated Worth: $ 1,200.00

Search Engine Indexes

Google Indexed Pages: 204
Bing Indexed Pages: 2

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 548,824
Domain Authority: 13 ON 100

Web Server Information

Hosted IP Address:

97.74.144.127

Hosted Country:

United States of America US

Location Latitude:

33.6119

Location Longitude:

-111.8906

Websites Hosted on Same IP (i.e. 97.74.144.127)

راه کارگر نیوز

- rahekaregarnews.com

rahekaregar, راه کارگر,culture, rahekargar, iran, , politics, politic, left, socialism, ایران , news, persian, politics, news, revolution, reform, country, Teheran, Tabriz, Karaj, mashahd, abadan, kurdistan, kurdestan, rasht, ardebil, sanandaj, baneh, rahe karegar

1,387,314 $ 480.00

My Website | Just another WordPress site

- poolcleaningservicerepairmckinney.com
Not Applicable $ 8.95

Pool Cleaning and Repair Frisco Texas | Pool Cleaning Service and Repa

- poolcleaningservicerepairfrisco.com
Not Applicable $ 8.95

F.C. Playa Vista

- fcplayavista.com

FC Playa Vista is a recrational soccer club located in Marina Del Rey, California near Playa Vista. We have just begun expanding the club and will build several teams to play throughout Los Angeles.

Not Applicable $ 8.95

Luke's Cafe 823 West Main St Abingdon, VA

- lukescafe.us

Luke's Cafe 823 West Main St Abingdon, VA 276-623-2233 | info@lukescafe.us

Not Applicable $ 8.95

Domain Information

Domain Registrar: DropCatch.com 1498 LLC
Registration Date: May 26, 2009, 12:00 AM 1 decade 4 years 10 months ago
Last Modified: May 2, 2012, 12:00 AM 1 decade 1 year 11 months ago
Expiration Date: May 26, 2014, 12:00 AM 9 years 11 months 2 hours ago

Domain Nameserver Information

Host IP Address Country
ns03.domaincontrol.com 97.74.101.2 United States of America United States of America
ns04.domaincontrol.com 173.201.69.2 United States of America United States of America

Similarly Ranked Websites

CarDealers.pk | Auto Dealers in Pakistan | Used Cars | Imported Cars

- cardealers.pk

Find Car Dealers across Pakistan and visit their online showrooms of Imported and Used autos

548,826 $ 1,200.00

Bienvenue

- sfds.asso.fr

Bienvenue.

548,826 $ 2,400.00

Startseite - Pflanzen-Janssen GmbH

- heckenpflanzen.de

Der Heckenspezialist, liefert bundesweit Heckenpflanzen zum günstigen Preis. Alle Hecken in bester Baumschulqualität. Online-bestellen mit Preis-Kalkulator.

548,827 $ 2,400.00

Avril Supermarché Santé

- avril.ca

Le meilleur de l'épicerie en ligne, des suppléments et des cosmétiques naturels.

548,828 $ 1,200.00

DLGAMES - Download All Your Games For Free

- dlgames.fun

DlGames - free download pc game, ps3 games , ps4 games ,xbox games, skidrow, hoodlum, elamigos, repack, full iso, direct link, single link, cracked pc games

548,828 $ 2,400.00